PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g17280.1.p
Common NameBRADI_2g17280, LOC100844971
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 291aa    MW: 30938.8 Da    PI: 6.9802
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g17280.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-161462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEde+l ++v+ +G g +W + +++ g++R++k+c++rw++yl
  Bradi2g17280.1.p 14 RGPWSPEEDEQLRRYVRAHGIGgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                      89******************999************************97 PP

2Myb_DNA-binding33.97.2e-1171111446
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        T+eEd  +  +    G++ W+ Ia++++ gRt++++k++w++
  Bradi2g17280.1.p  71 YTAEEDRVICSLYGSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                       69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.714966IPR017930Myb domain
SuperFamilySSF466898.36E-2711109IPR009057Homeodomain-like
SMARTSM007174.8E-121364IPR001005SANT/Myb domain
PfamPF002491.4E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-231569IPR009057Homeodomain-like
CDDcd001676.66E-101662No hitNo description
PROSITE profilePS5129414.37567117IPR017930Myb domain
SMARTSM007177.8E-1067115IPR001005SANT/Myb domain
PfamPF002493.2E-969111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2170116IPR009057Homeodomain-like
CDDcd001676.18E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWSPE EDEQLRRYVR AHGIGGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPDIRHGG YTAEEDRVIC SLYGSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKAVAM  120
GMQHATGGSA FSAPHSQCAL SPAASGSSSS TVDTTSSSAG GDIFFAAAMD QQPWPPQGLL  180
THFHAQSEPP APVLPSPDTV ALDVVSGAAG DWAHGPMDNV DVFLPELGGT GEQSLLFPYG  240
ELLFSGLLLQ ADQDQCKAAA VGVGGGVEHL SASTCSYFFP NSNMAEITYN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3581611e-130AK358161.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1070D08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565943.10.0PREDICTED: transcription factor RAX1-like
TrEMBLI1HGP80.0I1HGP8_BRADI; Uncharacterized protein
STRINGBRADI2G17280.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-69myb domain protein 36